Dettagli progetto

Description

Col presente progetto ci proponiamo di sviluppare una strategia terapeutica innovativa in grado di ridurre i livelli di LDL-colesterolo (LDL-C) in pazienti affetti da severa ipercolesterolemia familiare (FH). Tale strategia si basa sulla inattivazione della proteina PCSK9 (proprotein convertase subtilisin/kexin type 9) da parte di un peptide sintetico o ricombinante che contiene la sequenza aminoacidica del dominio EGF-A del recettore per le LDL (LDL-R). Il peptide EGF-A legandosi a PCSK9 impedirà a questa proteina di interagire con LDL-R, che quindi non verrà degradato. L’effetto netto sarà un aumento deI numero di LDL-R sulle membrane cellulari, con conseguente riduzione dei livelli di colesterolo plasmatici. I pazienti che potranno beneficiare di tale strategia sono gli FH omozigoti con un’attività residua del LDL-R, per i quali la terapia standard (LDL-aferesi e statine) non è sufficiente a far raggiungere i livelli raccomandati di LDL-C, nonchè gli FH eterozigoti che rispondono poco all’attuale terapia farmacologica e che pertanto rimangono ad elevato rischio di malattia cardiovascolare. Il progetto è disegnato per stabilire se un peptide EGF-A prodotto per sintesi e mediante tecnologia ricombinante) sia in grado di: 1) legare il PCSK9 secreto; 2) ridurre la degradazione di LDL-R PCSK9-mediata; 3) aumentare il numero di LDL-R sulla superficie cellulare. Verificheremo quindi l'ipotesi che un peptide EGF-A sia in grado di competere con il dominio naturale EGF-A presente sul LDL-R, per il legame con la proteina di PCSK9; quest’ultima verrà in tal modo funzionalmente inattivata con la conseguente riduzione dei livelli plasmatici di LDL-C. Il primo obiettivo dovrà essere la dimostrazione dell’esistenza di una interazione tra la proteina ricombinante PCSK9 (recPCSK9) ed un peptide EGF-A sintetico/ricombinante (sEGF-A/recEGF-A). Le proteine ricombinanti saranno sintetizzate sia in batteri che in cellule eucariotiche. Per lo studio delle interazioni sarà utilizzata inizialmente la proteina ricombinante recPCSK9 prodotta in batteri. Poiché il folding di una proteina ricombinante prodotta in cellule procariotiche può talvolta risultare in una proteina funzionalmente inattiva, verranno prodotte proteine ricombinanti anche in cellule eucariotiche (HEK-293). Il peptide sintetico sEGF-A verrà ottenuto da una azienda che fornisce un un servizio di sintesi di peptidi ad elevato grado di purezza. Al fine di valutare la porzione più piccola di questo peptide sintetico capace di legare la proteina recPCSK9 si procederà alla digestione triptica e alla purificazione dei frammenti che ne derivano per ulteriori analisi di legame. Le interazioni tra recPCSK9 con sEGF-A e con recEGF-A verrà valutata in vitro mediante esperimenti di co-immunoprecipitazione, western blot e saggi di binding in fase solida. Nella seconda parte del progetto di ricerca verranno eseguiti studi “in vitro” disegnati per valutare la riduzione della degradazione del LDL-R dopo aggiunta di peptide EGF-A a cellule in coltura che esprimono PCSK9 (HepG2 e HEK-293) e a fibroblasti di pazienti con FH-1 omozigote con attività residua del LDL-R. L'efficacia del peptide EGF-A sulla degradazione del LDL-R sarà valutata mediante western blot ed esperimenti di binding ed internalizzazione di LDL marcate. L’attività “terapeutica” del peptide EGF-A dovrebbe produrre un incremento misurabile del numero e della funzione dei recettori LDL sulla superficie cellulare; questo risultato fornirebbe le basi sperimentali per translare tale approccio in clinica. Infatti la conferma di tale risultato in trias clinici su pazienti FH-1 omo ed eterozigoti aprirebbe la strada ad una nuova terapia dell’Ipercolesterolemia Familiare.

Layman's description

OBIETTIVI: Il progetto di ricerca è finalizzato allo sviluppo di una nuova strategia terapeutica per ridurre i livelli di LDL-C nei pazienti affetti da forme severe di Ipercolesterolemia Familiare. L’approccio proposto è basato sull'inattivazione della forma secreta della proteina PCSK9 utilizzando un peptide che contiene la sequenza amminoacidica del dominio EGF-A del LDL-R. Gli obiettivi specifici del progetto sono i seguenti: A) dimostrare che un peptide EGF-A sintetico o ricombinante è in grado di legare la proteina PCSK9 ricombinante prodotta in batteri e in cellule eucariotiche. In particolare valuteremo: 1) quali forme di peptide EGF-A (sintetico o ricombinante) e proteina PCSK9 sono più adatti per i successivi esperimenti funzionali; 2) qual è il frammento del peptide EGF-A più piccolo in grado di legare la proteina PCSK9; e 3) il rapporto molare ottimale per il legame. B) dimostrare che il peptide EGF-A (sintetico o ricombinante) è in grado di competere con il dominio naturale EGF-A del LDL-R per il legame con la proteina PCSK9. L’efficacia del peptide EGF-A, nel ridurre la degradazione del LDL-R mediata dalla proteina PCSK9, verrà valutata mediante l’analisi dell’incremento dei livelli del LDL-R e della captazione delle LDL in vitro. In particolare valuteremo: 1) la curva dose-risposta del peptide EGF-A, sia sintetico che ricombinante, in termini di aumentata captazione delle LDL e 2) le differenze tra peptide EGF-A sintetico e ricombinante. C) dimostrare che il peptide EGF-A è in grado di aumentare il numero e la funzione di LDL-R in fibroblasti di pazienti omozigoti FH-1 con un’attività residua recettoriale tra il 10 e 20 %. I fibroblasti notoriamente non esprimono il PCSK9 ma rappresentano un modello adeguato per esplorare l’abilità di questo peptide nell’incrementare il numero e la funzione del LDL-R in un sistema cellulare che mima la condizione di difetto recettoriale dei pazienti FH-1 omozigoti. Intendiamo dimostrare che l’aggiunta del peptide EGF-A è in grado di aumentare il numero di LDL-R e quindi di ottenere un fenotipo sovrapponibile a quello FH-1 eterozigote che traslato in un modello clinico restaurerebbe la risposta ai farmaci ipocolesterolemizzanti. MEDOTI: Per raggiungere gli obiettivi di questo progetto verranno utilizzate le seguenti metodologie: Obiettivo A) 1) sintesi di un peptide sEGF-A Un peptide sintetico di 40mer(TNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCED) del dominio EGF-A sarà sintetizzato da Genscript (USA). 2) espressione della proteina recPCSK9 e peptide recEGF-A in batteri e cellule eucariotiche La regione codificante del cDNA di PCSK9 sarà clonato in un vettore di espressione (pQE Tri-System) ed espresso come recPCSK9 in E. Coli con una His tag all’estremità C-terminale. La proteina sarà purificata tramite cromatografia di affinità e gel filtrazione con una colonna Sephadex G70 in FPLC. Le proteine ricombinanti recPCSK9 e recEGF-A saranno espresse in cellule eucariotiche HEK-293 (FreeStyle- Invitrogen) utilizzando il vettore pCMV SPORT-beta-gal. 3) digestione triptica del peptide sEGF-A e purificazione dei frammenti di digestione. La digestione triptica del peptide sEGF-A genera 3 frammenti che saranno purificati mediante HPLC con una colonna C18 ODS2 in gradiente di H2O/acetonitrile. 4) valutazione dell’interazione tra recPCSK9 sia con sEGF-A che con recEGF-A L’interazione tra recPCSK9 sia con sEGF-A che con recEGF-A verrà valutata mediante co-immunoprecipitazione. Il peptide sEGF-A sarà marcato mediante biotinilazione con un kit commerciale (Roche). L’immunoprecipitazione verrà eseguita con un anticorpo anti-His. Per la visualizzazione mediante western blot verrà utilizzato un kit streptavidina-POD (Amersham). Il recEGF-A conterrà una tag M2 al C-terminale ed il western blot sarà condotto come descritto usando un anticorpo anti-M2. Un test di conferma dell’eventuale legame sarà eseguito median
StatoAttivo
Data di inizio/fine effettiva1/1/07 → …

Fingerprint

Esplora i temi di ricerca toccati da questo progetto. Queste etichette sono generate sulla base dei riconoscimenti/sovvenzioni sottostanti. Insieme formano una fingerprint unica.